mdrecipesmd.com
back to 100krunnerpescatarian

$ cat recipes/harbor-rainy-day-japanese-corn-pepper-scramble-bake-029354.md

Harbor Rainy-Day Japanese Corn Pepper Scramble Bake

^_^ cozy - Harbor Rainy-Day Japanese Corn Pepper Scramble Bake is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly
categorybreakfastdietpescatarianleveleasykcal411

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

  • harbor rainy-day japanese
  • rolled oats
  • parsley
  • cumin
  • olive oil
  • kosher salt
  • black pepper
  • garlic
  • lemon

Steps

  1. Prep all vegetables, aromatics, and protein before heat touches the pan.
  2. Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
  3. Add liquid or sauce in stages, tasting once midway and once before serving.
  4. Plate hot with herbs, acid, and a final grind of pepper.