$ cat recipes/harbor-rainy-day-ontario-corn-pepper-oat-plate-028269.md

Harbor Rainy-Day Ontario Corn Pepper Oat Plate

Name: Harbor Rainy-Day Ontario Corn Pepper Oat Plate
Prep time: 22 min
Cook time: 18 min
Total time: 40 min
Yield: 5 servings
Ingredients: harbor rainy-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Rainy-Day Ontario Corn Pepper Oat Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Rainy-Day Ontario Corn Pepper Oat Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       18 min
total      40 min
servings   5
protein    25 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal446

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor rainy-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.