$ cat recipes/harbor-spring-indian-spinach-feta-yogurt-cup-bake-026959.md

Harbor Spring Indian Spinach Feta Yogurt Cup Bake

Name: Harbor Spring Indian Spinach Feta Yogurt Cup Bake
Prep time: 8 min
Cook time: 44 min
Total time: 52 min
Yield: 5 servings
Ingredients: harbor spring indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Spring Indian Spinach Feta Yogurt Cup Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Spring Indian Spinach Feta Yogurt Cup Bake

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       44 min
total      52 min
servings   5
protein    11 g
pantry     84/100

categorybreakfastdietpescatarianleveleasykcal486

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor spring indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.