$ cat recipes/harbor-spring-mexican-miso-scallion-pancake-stack-029429.md

Harbor Spring Mexican Miso Scallion Pancake Stack

Name: Harbor Spring Mexican Miso Scallion Pancake Stack
Prep time: 26 min
Cook time: 44 min
Total time: 70 min
Yield: 5 servings
Ingredients: harbor spring mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Spring Mexican Miso Scallion Pancake Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Spring Mexican Miso Scallion Pancake Stack

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       44 min
total      70 min
servings   5
protein    11 g
pantry     71/100

categorybreakfastdietpescatarianlevelmediumkcal246

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor spring mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.