$ cat recipes/harbor-summer-brazilian-tomato-basil-scramble-hash-028849.md

Harbor Summer Brazilian Tomato Basil Scramble Hash

Name: Harbor Summer Brazilian Tomato Basil Scramble Hash
Prep time: 24 min
Cook time: 12 min
Total time: 36 min
Yield: 5 servings
Ingredients: harbor summer brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Summer Brazilian Tomato Basil Scramble Hash is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Harbor Summer Brazilian Tomato Basil Scramble Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       12 min
total      36 min
servings   5
protein    37 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal346

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor summer brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.