$ cat recipes/harbor-summer-mediterranean-lemon-herb-egg-stack-025379.md

Harbor Summer Mediterranean Lemon Herb Egg Stack

Name: Harbor Summer Mediterranean Lemon Herb Egg Stack
Prep time: 20 min
Cook time: 42 min
Total time: 62 min
Yield: 5 servings
Ingredients: harbor summer mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Summer Mediterranean Lemon Herb Egg Stack is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Summer Mediterranean Lemon Herb Egg Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       42 min
total      62 min
servings   5
protein    15 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal336

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor summer mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.