$ cat recipes/harbor-sunday-brazilian-garlic-butter-yogurt-cup-stack-027929.md

Harbor Sunday Brazilian Garlic Butter Yogurt Cup Stack

Name: Harbor Sunday Brazilian Garlic Butter Yogurt Cup Stack
Prep time: 14 min
Cook time: 32 min
Total time: 46 min
Yield: 5 servings
Ingredients: harbor sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Sunday Brazilian Garlic Butter Yogurt Cup Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Sunday Brazilian Garlic Butter Yogurt Cup Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       32 min
total      46 min
servings   5
protein    35 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.