$ cat recipes/harbor-sunday-british-spinach-feta-overnight-oat-cup-026134.md

Harbor Sunday British Spinach Feta Overnight Oat Cup

Name: Harbor Sunday British Spinach Feta Overnight Oat Cup
Prep time: 19 min
Cook time: 45 min
Total time: 64 min
Yield: 5 servings
Ingredients: harbor sunday british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Sunday British Spinach Feta Overnight Oat Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Sunday British Spinach Feta Overnight Oat Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       45 min
total      64 min
servings   5
protein    28 g
pantry     70/100

categorybreakfastdietpescatarianleveleasykcal341

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor sunday british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.