$ cat recipes/harbor-sunday-french-sesame-ginger-yogurt-cup-hash-025949.md

Harbor Sunday French Sesame Ginger Yogurt Cup Hash

Name: Harbor Sunday French Sesame Ginger Yogurt Cup Hash
Prep time: 14 min
Cook time: 42 min
Total time: 56 min
Yield: 5 servings
Ingredients: harbor sunday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Sunday French Sesame Ginger Yogurt Cup Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Sunday French Sesame Ginger Yogurt Cup Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       42 min
total      56 min
servings   5
protein    15 g
pantry     85/100

categorybreakfastdietpescatarianleveleasykcal356

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor sunday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.