$ cat recipes/harbor-sunday-mexican-lemon-herb-oat-cup-026734.md

Harbor Sunday Mexican Lemon Herb Oat Cup

Name: Harbor Sunday Mexican Lemon Herb Oat Cup
Prep time: 15 min
Cook time: 27 min
Total time: 42 min
Yield: 5 servings
Ingredients: harbor sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Sunday Mexican Lemon Herb Oat Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Sunday Mexican Lemon Herb Oat Cup

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       27 min
total      42 min
servings   5
protein    26 g
pantry     69/100

categorybreakfastdietpescatarianlevelmediumkcal491

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.