$ cat recipes/harbor-sunday-mexican-tomato-basil-egg-hash-025844.md

Harbor Sunday Mexican Tomato Basil Egg Hash

Name: Harbor Sunday Mexican Tomato Basil Egg Hash
Prep time: 7 min
Cook time: 29 min
Total time: 36 min
Yield: 5 servings
Ingredients: harbor sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Sunday Mexican Tomato Basil Egg Hash is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Sunday Mexican Tomato Basil Egg Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       7 min
cook       29 min
total      36 min
servings   5
protein    22 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal391

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.