$ cat recipes/harbor-winter-brazilian-lemon-herb-egg-stack-028824.md

Harbor Winter Brazilian Lemon Herb Egg Stack

Name: Harbor Winter Brazilian Lemon Herb Egg Stack
Prep time: 15 min
Cook time: 27 min
Total time: 42 min
Yield: 5 servings
Ingredients: harbor winter brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Winter Brazilian Lemon Herb Egg Stack is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Winter Brazilian Lemon Herb Egg Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       27 min
total      42 min
servings   5
protein    26 g
pantry     58/100

categorybreakfastdietpescatarianleveleasykcal401

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor winter brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.