$ cat recipes/harbor-winter-british-sweet-potato-breakfast-wrap-bake-025254.md

Harbor Winter British Sweet Potato Breakfast Wrap Bake

Name: Harbor Winter British Sweet Potato Breakfast Wrap Bake
Prep time: 19 min
Cook time: 41 min
Total time: 60 min
Yield: 5 servings
Ingredients: harbor winter british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Winter British Sweet Potato Breakfast Wrap Bake is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Harbor Winter British Sweet Potato Breakfast Wrap Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       41 min
total      60 min
servings   5
protein    36 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal611

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor winter british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.