$ cat recipes/harbor-winter-ontario-spinach-feta-oat-stack-028229.md

Harbor Winter Ontario Spinach Feta Oat Stack

Name: Harbor Winter Ontario Spinach Feta Oat Stack
Prep time: 12 min
Cook time: 42 min
Total time: 54 min
Yield: 5 servings
Ingredients: harbor winter ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Harbor Winter Ontario Spinach Feta Oat Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Winter Ontario Spinach Feta Oat Stack

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       42 min
total      54 min
servings   5
protein    15 g
pantry     73/100

categorybreakfastdietpescatarianleveleasykcal436

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor winter ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.