$ cat recipes/harbor-winter-taiwanese-sesame-ginger-overnight-oat-stack-028124.md

Harbor Winter Taiwanese Sesame Ginger Overnight Oat Stack

Name: Harbor Winter Taiwanese Sesame Ginger Overnight Oat Stack
Prep time: 27 min
Cook time: 29 min
Total time: 56 min
Yield: 5 servings
Ingredients: harbor winter taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Harbor Winter Taiwanese Sesame Ginger Overnight Oat Stack is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Harbor Winter Taiwanese Sesame Ginger Overnight Oat Stack

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       29 min
total      56 min
servings   5
protein    22 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal471

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

harbor winter taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.