$ cat recipes/holiday-indian-spinach-feta-breakfast-wrap-stack-3224.md

Holiday Indian Spinach Feta Breakfast Wrap Stack

Name: Holiday Indian Spinach Feta Breakfast Wrap Stack
Prep time: 17 min
Cook time: 35 min
Total time: 52 min
Yield: 5 servings
Ingredients: holiday indian spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Holiday Indian Spinach Feta Breakfast Wrap Stack is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Indian Spinach Feta Breakfast Wrap Stack

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       17 min
cook       35 min
total      52 min
servings   5
protein    10 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal371

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday indian spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.