$ cat recipes/holiday-indian-spinach-feta-oat-stack-3229.md

Holiday Indian Spinach Feta Oat Stack

Name: Holiday Indian Spinach Feta Oat Stack
Prep time: 10 min
Cook time: 32 min
Total time: 42 min
Yield: 5 servings
Ingredients: holiday indian spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Holiday Indian Spinach Feta Oat Stack is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Indian Spinach Feta Oat Stack

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       10 min
cook       32 min
total      42 min
servings   5
protein    35 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday indian spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.