$ cat recipes/holiday-japanese-garlic-butter-yogurt-cup-stack-3929.md

Holiday Japanese Garlic Butter Yogurt Cup Stack

Name: Holiday Japanese Garlic Butter Yogurt Cup Stack
Prep time: 20 min
Cook time: 30 min
Total time: 50 min
Yield: 5 servings
Ingredients: holiday japanese garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Holiday Japanese Garlic Butter Yogurt Cup Stack is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Japanese Garlic Butter Yogurt Cup Stack

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       20 min
cook       30 min
total      50 min
servings   5
protein    39 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal486

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday japanese garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.