$ cat recipes/holiday-ontario-sweet-potato-overnight-oat-plate-4619.md

Holiday Ontario Sweet Potato Overnight Oat Plate

Name: Holiday Ontario Sweet Potato Overnight Oat Plate
Prep time: 22 min
Cook time: 34 min
Total time: 56 min
Yield: 5 servings
Ingredients: holiday ontario sweet; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Holiday Ontario Sweet Potato Overnight Oat Plate is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Ontario Sweet Potato Overnight Oat Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       22 min
cook       34 min
total      56 min
servings   5
protein    31 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal536

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday ontario sweet
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.