$ cat recipes/holiday-taiwanese-lemon-herb-breakfast-wrap-cup-2739.md

Holiday Taiwanese Lemon Herb Breakfast Wrap Cup

Name: Holiday Taiwanese Lemon Herb Breakfast Wrap Cup
Prep time: 14 min
Cook time: 22 min
Total time: 36 min
Yield: 5 servings
Ingredients: holiday taiwanese lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Holiday Taiwanese Lemon Herb Breakfast Wrap Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Taiwanese Lemon Herb Breakfast Wrap Cup

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       14 min
cook       22 min
total      36 min
servings   5
protein    17 g
pantry     82/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday taiwanese lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.