$ cat recipes/holiday-taiwanese-miso-scallion-toast-plate-4519.md

Holiday Taiwanese Miso Scallion Toast Plate

Name: Holiday Taiwanese Miso Scallion Toast Plate
Prep time: 8 min
Cook time: 18 min
Total time: 26 min
Yield: 5 servings
Ingredients: holiday taiwanese miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Holiday Taiwanese Miso Scallion Toast Plate is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Holiday Taiwanese Miso Scallion Toast Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       8 min
cook       18 min
total      26 min
servings   5
protein    25 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket...

Ingredients

holiday taiwanese miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.