$ cat recipes/juniper-fall-brazilian-sweet-potato-egg-muffin-stack-071524.md

Juniper Fall Brazilian Sweet Potato Egg Muffin Stack No. 071524

Name: Juniper Fall Brazilian Sweet Potato Egg Muffin Stack No. 071524
Prep time: 9 min
Cook time: 19 min
Total time: 28 min
Yield: 5 servings
Ingredients: juniper fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Fall Brazilian Sweet Potato Egg Muffin Stack No. 071524 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Fall Brazilian Sweet Potato Egg Muffin Stack No. 071524

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       19 min
total      28 min
servings   5
protein    42 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal541

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.