$ cat recipes/juniper-fall-mediterranean-sweet-potato-smoothie-plate-072614.md

Juniper Fall Mediterranean Sweet Potato Smoothie Plate No. 072614

Name: Juniper Fall Mediterranean Sweet Potato Smoothie Plate No. 072614
Prep time: 23 min
Cook time: 11 min
Total time: 34 min
Yield: 5 servings
Ingredients: juniper fall mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Fall Mediterranean Sweet Potato Smoothie Plate No. 072614 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Fall Mediterranean Sweet Potato Smoothie Plate No. 072614

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       11 min
total      34 min
servings   5
protein    20 g
pantry     80/100

categorybreakfastdietpescatarianleveleasykcal201

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper fall mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.