$ cat recipes/juniper-holiday-british-miso-scallion-yogurt-cup-stack-073424.md

Juniper Holiday British Miso Scallion Yogurt Cup Stack No. 073424

Name: Juniper Holiday British Miso Scallion Yogurt Cup Stack No. 073424
Prep time: 11 min
Cook time: 19 min
Total time: 30 min
Yield: 5 servings
Ingredients: juniper holiday british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Holiday British Miso Scallion Yogurt Cup Stack No. 073424 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Holiday British Miso Scallion Yogurt Cup Stack No. 073424

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       19 min
total      30 min
servings   5
protein    42 g
pantry     93/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper holiday british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.