$ cat recipes/juniper-holiday-indian-tomato-basil-overnight-oat-plate-079669.md

Juniper Holiday Indian Tomato Basil Overnight Oat Plate No. 079669

Name: Juniper Holiday Indian Tomato Basil Overnight Oat Plate No. 079669
Prep time: 24 min
Cook time: 34 min
Total time: 58 min
Yield: 5 servings
Ingredients: juniper holiday indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Holiday Indian Tomato Basil Overnight Oat Plate No. 079669 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Holiday Indian Tomato Basil Overnight Oat Plate No. 079669

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       34 min
total      58 min
servings   5
protein    31 g
pantry     72/100

categorybreakfastdietpescatarianleveleasykcal556

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper holiday indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.