$ cat recipes/juniper-late-night-brazilian-spinach-feta-breakfast-wrap-stack-074224.md

Juniper Late-Night Brazilian Spinach Feta Breakfast Wrap Stack No. 074224

Name: Juniper Late-Night Brazilian Spinach Feta Breakfast Wrap Stack No. 074224
Prep time: 13 min
Cook time: 33 min
Total time: 46 min
Yield: 5 servings
Ingredients: juniper late-night brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Late-Night Brazilian Spinach Feta Breakfast Wrap Stack No. 074224 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Late-Night Brazilian Spinach Feta Breakfast Wrap Stack No. 074224

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       33 min
total      46 min
servings   5
protein    14 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal481

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper late-night brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.