$ cat recipes/juniper-late-night-british-sesame-ginger-oat-plate-070764.md

Juniper Late-Night British Sesame Ginger Oat Plate No. 070764

Name: Juniper Late-Night British Sesame Ginger Oat Plate No. 070764
Prep time: 17 min
Cook time: 19 min
Total time: 36 min
Yield: 5 servings
Ingredients: juniper late-night british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Late-Night British Sesame Ginger Oat Plate No. 070764 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Late-Night British Sesame Ginger Oat Plate No. 070764

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       19 min
total      36 min
servings   5
protein    42 g
pantry     66/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper late-night british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.