$ cat recipes/juniper-late-night-french-corn-pepper-scramble-bake-076809.md

Juniper Late-Night French Corn Pepper Scramble Bake No. 076809

Name: Juniper Late-Night French Corn Pepper Scramble Bake No. 076809
Prep time: 24 min
Cook time: 40 min
Total time: 64 min
Yield: 5 servings
Ingredients: juniper late-night french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Late-Night French Corn Pepper Scramble Bake No. 076809 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Late-Night French Corn Pepper Scramble Bake No. 076809

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       40 min
total      64 min
servings   5
protein    19 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal576

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper late-night french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.