$ cat recipes/juniper-late-night-taiwanese-sweet-potato-egg-muffin-stack-079079.md

Juniper Late-Night Taiwanese Sweet Potato Egg Muffin Stack No. 079079

Name: Juniper Late-Night Taiwanese Sweet Potato Egg Muffin Stack No. 079079
Prep time: 14 min
Cook time: 8 min
Total time: 22 min
Yield: 5 servings
Ingredients: juniper late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Late-Night Taiwanese Sweet Potato Egg Muffin Stack No. 079079 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Late-Night Taiwanese Sweet Potato Egg Muffin Stack No. 079079

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       8 min
total      22 min
servings   5
protein    7 g
pantry     60/100

categorybreakfastdietpescatarianleveleasykcal286

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.