$ cat recipes/juniper-lunchbox-japanese-sesame-ginger-yogurt-cup-hash-078494.md

Juniper Lunchbox Japanese Sesame Ginger Yogurt Cup Hash No. 078494

Name: Juniper Lunchbox Japanese Sesame Ginger Yogurt Cup Hash No. 078494
Prep time: 19 min
Cook time: 17 min
Total time: 36 min
Yield: 5 servings
Ingredients: juniper lunchbox japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Lunchbox Japanese Sesame Ginger Yogurt Cup Hash No. 078494 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Lunchbox Japanese Sesame Ginger Yogurt Cup Hash No. 078494

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       19 min
cook       17 min
total      36 min
servings   5
protein    8 g
pantry     62/100

categorybreakfastdietpescatarianleveleasykcal201

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper lunchbox japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.