$ cat recipes/juniper-lunchbox-mediterranean-coconut-lime-egg-stack-075329.md

Juniper Lunchbox Mediterranean Coconut Lime Egg Stack No. 075329

Name: Juniper Lunchbox Mediterranean Coconut Lime Egg Stack No. 075329
Prep time: 6 min
Cook time: 16 min
Total time: 22 min
Yield: 5 servings
Ingredients: juniper lunchbox mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Lunchbox Mediterranean Coconut Lime Egg Stack No. 075329 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Lunchbox Mediterranean Coconut Lime Egg Stack No. 075329

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       16 min
total      22 min
servings   5
protein    29 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal206

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper lunchbox mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.