$ cat recipes/juniper-market-day-brazilian-spinach-feta-smoothie-cup-075139.md

Juniper Market-Day Brazilian Spinach Feta Smoothie Cup No. 075139

Name: Juniper Market-Day Brazilian Spinach Feta Smoothie Cup No. 075139
Prep time: 8 min
Cook time: 16 min
Total time: 24 min
Yield: 5 servings
Ingredients: juniper market-day brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Market-Day Brazilian Spinach Feta Smoothie Cup No. 075139 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Market-Day Brazilian Spinach Feta Smoothie Cup No. 075139

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       16 min
total      24 min
servings   5
protein    29 g
pantry     98/100

categorybreakfastdietpescatarianlevelmediumkcal526

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper market-day brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.