$ cat recipes/juniper-market-day-indian-garlic-butter-yogurt-cup-stack-076929.md

Juniper Market-Day Indian Garlic Butter Yogurt Cup Stack No. 076929

Name: Juniper Market-Day Indian Garlic Butter Yogurt Cup Stack No. 076929
Prep time: 10 min
Cook time: 44 min
Total time: 54 min
Yield: 5 servings
Ingredients: juniper market-day indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Market-Day Indian Garlic Butter Yogurt Cup Stack No. 076929 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Market-Day Indian Garlic Butter Yogurt Cup Stack No. 076929

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       44 min
total      54 min
servings   5
protein    11 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper market-day indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.