$ cat recipes/juniper-market-day-mediterranean-corn-pepper-yogurt-cup-hash-079999.md

Juniper Market-Day Mediterranean Corn Pepper Yogurt Cup Hash

Name: Juniper Market-Day Mediterranean Corn Pepper Yogurt Cup Hash
Prep time: 24 min
Cook time: 26 min
Total time: 50 min
Yield: 5 servings
Ingredients: juniper market-day mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Market-Day Mediterranean Corn Pepper Yogurt Cup Hash is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Market-Day Mediterranean Corn Pepper Yogurt Cup Hash

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       26 min
total      50 min
servings   5
protein    9 g
pantry     94/100

categorybreakfastdietpescatarianleveleasykcal516

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper market-day mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.