$ cat recipes/juniper-market-day-mexican-sesame-ginger-yogurt-cup-hash-079494.md

Juniper Market-Day Mexican Sesame Ginger Yogurt Cup Hash

Name: Juniper Market-Day Mexican Sesame Ginger Yogurt Cup Hash
Prep time: 27 min
Cook time: 25 min
Total time: 52 min
Yield: 5 servings
Ingredients: juniper market-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Market-Day Mexican Sesame Ginger Yogurt Cup Hash is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Juniper Market-Day Mexican Sesame Ginger Yogurt Cup Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       25 min
total      52 min
servings   5
protein    30 g
pantry     74/100

categorybreakfastdietpescatarianleveleasykcal451

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper market-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.