$ cat recipes/juniper-rainy-day-british-garlic-butter-breakfast-wrap-hash-070749.md

Juniper Rainy-Day British Garlic Butter Breakfast Wrap Hash No. 070749

Name: Juniper Rainy-Day British Garlic Butter Breakfast Wrap Hash No. 070749
Prep time: 16 min
Cook time: 28 min
Total time: 44 min
Yield: 5 servings
Ingredients: juniper rainy-day british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Rainy-Day British Garlic Butter Breakfast Wrap Hash No. 070749 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Rainy-Day British Garlic Butter Breakfast Wrap Hash No. 070749

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       28 min
total      44 min
servings   5
protein    43 g
pantry     65/100

categorybreakfastdietpescatarianleveleasykcal286

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper rainy-day british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.