$ cat recipes/juniper-rainy-day-french-lemon-herb-egg-muffin-bake-074009.md

Juniper Rainy-Day French Lemon Herb Egg Muffin Bake No. 074009

Name: Juniper Rainy-Day French Lemon Herb Egg Muffin Bake No. 074009
Prep time: 6 min
Cook time: 10 min
Total time: 16 min
Yield: 5 servings
Ingredients: juniper rainy-day french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Rainy-Day French Lemon Herb Egg Muffin Bake No. 074009 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Rainy-Day French Lemon Herb Egg Muffin Bake No. 074009

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       10 min
total      16 min
servings   5
protein    41 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal366

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper rainy-day french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.