$ cat recipes/juniper-rainy-day-indian-sweet-potato-yogurt-cup-cup-071434.md

Juniper Rainy-Day Indian Sweet Potato Yogurt Cup Cup No. 071434

Name: Juniper Rainy-Day Indian Sweet Potato Yogurt Cup Cup No. 071434
Prep time: 25 min
Cook time: 35 min
Total time: 60 min
Yield: 5 servings
Ingredients: juniper rainy-day indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Rainy-Day Indian Sweet Potato Yogurt Cup Cup No. 071434 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Rainy-Day Indian Sweet Potato Yogurt Cup Cup No. 071434

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       35 min
total      60 min
servings   5
protein    10 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper rainy-day indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.