$ cat recipes/juniper-rainy-day-ontario-lemon-herb-scramble-stack-077374.md

Juniper Rainy-Day Ontario Lemon Herb Scramble Stack No. 077374

Name: Juniper Rainy-Day Ontario Lemon Herb Scramble Stack No. 077374
Prep time: 25 min
Cook time: 43 min
Total time: 68 min
Yield: 5 servings
Ingredients: juniper rainy-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Rainy-Day Ontario Lemon Herb Scramble Stack No. 077374 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Rainy-Day Ontario Lemon Herb Scramble Stack No. 077374

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       25 min
cook       43 min
total      68 min
servings   5
protein    32 g
pantry     83/100

categorybreakfastdietpescatarianleveleasykcal411

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper rainy-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.