$ cat recipes/juniper-spring-british-tomato-basil-yogurt-cup-cup-078939.md

Juniper Spring British Tomato Basil Yogurt Cup Cup

Name: Juniper Spring British Tomato Basil Yogurt Cup Cup
Prep time: 12 min
Cook time: 16 min
Total time: 28 min
Yield: 5 servings
Ingredients: juniper spring british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Spring British Tomato Basil Yogurt Cup Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Juniper Spring British Tomato Basil Yogurt Cup Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       16 min
total      28 min
servings   5
protein    29 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal496

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.