$ cat recipes/juniper-spring-indian-miso-scallion-egg-muffin-plate-070514.md

Juniper Spring Indian Miso Scallion Egg Muffin Plate No. 070514

Name: Juniper Spring Indian Miso Scallion Egg Muffin Plate No. 070514
Prep time: 15 min
Cook time: 17 min
Total time: 32 min
Yield: 5 servings
Ingredients: juniper spring indian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Spring Indian Miso Scallion Egg Muffin Plate No. 070514 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Spring Indian Miso Scallion Egg Muffin Plate No. 070514

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       15 min
cook       17 min
total      32 min
servings   5
protein    8 g
pantry     63/100

categorybreakfastdietpescatarianleveleasykcal411

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring indian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.