$ cat recipes/juniper-spring-korean-miso-scallion-egg-cup-073884.md

Juniper Spring Korean Miso Scallion Egg Cup No. 073884

Name: Juniper Spring Korean Miso Scallion Egg Cup No. 073884
Prep time: 27 min
Cook time: 9 min
Total time: 36 min
Yield: 5 servings
Ingredients: juniper spring korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Spring Korean Miso Scallion Egg Cup No. 073884 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Spring Korean Miso Scallion Egg Cup No. 073884

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       9 min
total      36 min
servings   5
protein    24 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.