$ cat recipes/juniper-spring-korean-tomato-basil-smoothie-plate-070119.md

Juniper Spring Korean Tomato Basil Smoothie Plate No. 070119

Name: Juniper Spring Korean Tomato Basil Smoothie Plate No. 070119
Prep time: 18 min
Cook time: 26 min
Total time: 44 min
Yield: 5 servings
Ingredients: juniper spring korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Juniper Spring Korean Tomato Basil Smoothie Plate No. 070119 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Spring Korean Tomato Basil Smoothie Plate No. 070119

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       26 min
total      44 min
servings   5
protein    9 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal496

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.