$ cat recipes/juniper-spring-mexican-tomato-basil-breakfast-wrap-bake-071204.md

Juniper Spring Mexican Tomato Basil Breakfast Wrap Bake No. 071204

Name: Juniper Spring Mexican Tomato Basil Breakfast Wrap Bake No. 071204
Prep time: 17 min
Cook time: 21 min
Total time: 38 min
Yield: 5 servings
Ingredients: juniper spring mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Spring Mexican Tomato Basil Breakfast Wrap Bake No. 071204 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Juniper Spring Mexican Tomato Basil Breakfast Wrap Bake No. 071204

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       17 min
cook       21 min
total      38 min
servings   5
protein    38 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal461

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper spring mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.