$ cat recipes/juniper-summer-korean-sweet-potato-scramble-hash-078344.md
Juniper Summer Korean Sweet Potato Scramble Hash
^_^ cozy - Juniper Summer Korean Sweet Potato Scramble Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.
muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly
categorybreakfastdietpescatarianleveleasykcal531
$ price recipe --region auto
Estimating local basket from the detected market...
Ingredients
- juniper summer korean
- rolled oats
- parsley
- cumin
- olive oil
- kosher salt
- black pepper
- garlic
- lemon
Steps
- Prep all vegetables, aromatics, and protein before heat touches the pan.
- Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
- Add liquid or sauce in stages, tasting once midway and once before serving.
- Plate hot with herbs, acid, and a final grind of pepper.