$ cat recipes/juniper-summer-taiwanese-pesto-kale-scramble-plate-076364.md

Juniper Summer Taiwanese Pesto Kale Scramble Plate No. 076364

Name: Juniper Summer Taiwanese Pesto Kale Scramble Plate No. 076364
Prep time: 9 min
Cook time: 41 min
Total time: 50 min
Yield: 5 servings
Ingredients: juniper summer taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Summer Taiwanese Pesto Kale Scramble Plate No. 076364 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Summer Taiwanese Pesto Kale Scramble Plate No. 076364

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       41 min
total      50 min
servings   5
protein    36 g
pantry     84/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper summer taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.