$ cat recipes/juniper-sunday-brazilian-sesame-ginger-egg-muffin-cup-071584.md

Juniper Sunday Brazilian Sesame Ginger Egg Muffin Cup No. 071584

Name: Juniper Sunday Brazilian Sesame Ginger Egg Muffin Cup No. 071584
Prep time: 13 min
Cook time: 21 min
Total time: 34 min
Yield: 5 servings
Ingredients: juniper sunday brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Sunday Brazilian Sesame Ginger Egg Muffin Cup No. 071584 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Sunday Brazilian Sesame Ginger Egg Muffin Cup No. 071584

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       21 min
total      34 min
servings   5
protein    38 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal311

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper sunday brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.