$ cat recipes/juniper-sunday-taiwanese-tomato-basil-overnight-oat-plate-078114.md

Juniper Sunday Taiwanese Tomato Basil Overnight Oat Plate No. 078114

Name: Juniper Sunday Taiwanese Tomato Basil Overnight Oat Plate No. 078114
Prep time: 23 min
Cook time: 17 min
Total time: 40 min
Yield: 5 servings
Ingredients: juniper sunday taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Sunday Taiwanese Tomato Basil Overnight Oat Plate No. 078114 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Sunday Taiwanese Tomato Basil Overnight Oat Plate No. 078114

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       17 min
total      40 min
servings   5
protein    8 g
pantry     64/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper sunday taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.