$ cat recipes/juniper-winter-brazilian-corn-pepper-breakfast-wrap-plate-074264.md

Juniper Winter Brazilian Corn Pepper Breakfast Wrap Plate No. 074264

Name: Juniper Winter Brazilian Corn Pepper Breakfast Wrap Plate No. 074264
Prep time: 23 min
Cook time: 9 min
Total time: 32 min
Yield: 5 servings
Ingredients: juniper winter brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Winter Brazilian Corn Pepper Breakfast Wrap Plate No. 074264 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Juniper Winter Brazilian Corn Pepper Breakfast Wrap Plate No. 074264

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       9 min
total      32 min
servings   5
protein    24 g
pantry     67/100

categorybreakfastdietpescatarianlevelmediumkcal491

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.