$ cat recipes/juniper-winter-british-sweet-potato-breakfast-wrap-bake-075254.md

Juniper Winter British Sweet Potato Breakfast Wrap Bake No. 075254

Name: Juniper Winter British Sweet Potato Breakfast Wrap Bake No. 075254
Prep time: 23 min
Cook time: 23 min
Total time: 46 min
Yield: 5 servings
Ingredients: juniper winter british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Juniper Winter British Sweet Potato Breakfast Wrap Bake No. 075254 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Juniper Winter British Sweet Potato Breakfast Wrap Bake No. 075254

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       23 min
total      46 min
servings   5
protein    34 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal371

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

juniper winter british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.